4.67 Rating by ClearWebStats
multivisionpro.com is 3 years 7 months 2 days old. This website has a #4,173,873 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, multivisionpro.com is SAFE to browse.
Get Custom Widget

Traffic Report of Multivisionpro

Daily Unique Visitors: 115
Daily Pageviews: 230

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 4,173,873
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View multivisionpro.com site advisor rating Not Applicable

Where is multivisionpro.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with multivisionpro.com

Hosted Country:

multivisionpro.com hosted country US multivisionpro.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View multivisionpro.com HTML resources

Homepage Links Analysis

Multi Vision Pro

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

multivisionpro.com favicon - jenniferchemsales.com

View multivisionpro.com Pagerank   multivisionpro.com alexa rank Not Applicable   multivisionpro.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

multivisionpro.com favicon - shrivishwakarmasafetytraininginstitute.com

View multivisionpro.com Pagerank   multivisionpro.com alexa rank Not Applicable   multivisionpro.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

multivisionpro.com favicon - theshineenglishacademy.com

View multivisionpro.com Pagerank   multivisionpro.com alexa rank Not Applicable   multivisionpro.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

multivisionpro.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View multivisionpro.com Pagerank   multivisionpro.com alexa rank Not Applicable   multivisionpro.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

multivisionpro.com favicon - 247bestpillpharma.com

View multivisionpro.com Pagerank   multivisionpro.com alexa rank Not Applicable   multivisionpro.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 14 Oct 2020 23:28:42 GMT
Server: Apache
X-UA-Compatible: IE=edge
Link: <https://multivisionpro.com/wp-json/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5169
Content-Type: text/html; charset=UTF-8

Domain Information for multivisionpro.com

Domain Registrar: GODADDY.COM, LLC multivisionpro.com registrar info
Registration Date: 2020-10-10 3 years 7 months 2 days ago
Last Modified: 2020-10-10 3 years 7 months 2 days ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net multivisionpro.com name server information 162.241.148.33 multivisionpro.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net multivisionpro.com name server information 162.241.148.33 multivisionpro.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
multivisionpro.com A 14396 IP:162.241.148.33
multivisionpro.com NS 86400 Target:ns1.bh-ht-17.webhostbox.net
multivisionpro.com NS 86400 Target:ns2.bh-ht-17.webhostbox.net
multivisionpro.com SOA 86400 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:sampurnraj100.gmail.com
Serial:2020101002
Refresh:86400
Retry:7200
Expire:3600000
multivisionpro.com MX 14400 Target:mail.multivisionpro.com
multivisionpro.com TXT 14400 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Multivisionpro

Calm Dental —

multivisionpro.com favicon - dentist-of-downtown-los-angeles.com

View multivisionpro.com Pagerank   Alexa rank for multivisionpro.com 4,173,900   website value of multivisionpro.com $ 240.00

AZNews

multivisionpro.com favicon - aznews.in

Aznews Provides Latest News about Various fields as exams, admit cards, results and world news.

View multivisionpro.com Pagerank   Alexa rank for multivisionpro.com 4,173,902   website value of multivisionpro.com $ 240.00

Client Login | Dreamersi

multivisionpro.com favicon - dreamersi.net

DreamersI provides stable web and email hosting with a simple interface to manage websites and email accounts.

View multivisionpro.com Pagerank   Alexa rank for multivisionpro.com 4,173,913   website value of multivisionpro.com $ 240.00

Jobs at home | Work at home jobs | Work at home ideas | Work at home careers | Work At Home Business Ideas

multivisionpro.com favicon - homeworkerclub.com

News reporting services for work at home jobs and home income opportunities providing instant work at home jobs, work at home employment, work at home business opportunity, work at home tips, work at home advice and work at home reviews for ordinary people wanting to make money.

View multivisionpro.com Pagerank   Alexa rank for multivisionpro.com 4,173,919   website value of multivisionpro.com $ 240.00

Home | Gallagher Sharp

multivisionpro.com favicon - gallaghersharp.com

Capitalizing on 100 years of experience, Gallagher Sharp is a Cleveland Law firm that focuses on Appellate, Business & Employment, General Litigation, Insurance, Mass Tort/Toxic Tort, Product Liability, Professional Liability, and Transportation law. Offices located in Cleveland Ohio, Toledo Ohio, and Detroit Michigan.

View multivisionpro.com Pagerank   Alexa rank for multivisionpro.com 4,173,938   website value of multivisionpro.com $ 240.00

Full WHOIS Lookup for multivisionpro.com

Domain Name: MULTIVISIONPRO.COM
Registry Domain ID: 2564993745_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-10-10T17:29:42Z
Creation Date: 2020-10-10T16:28:46Z
Registry Expiry Date: 2022-10-10T16:28:46Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-10-14T23:28:31Z